Sign In | Join Free | My
Zhuhai Jiacheng Bio-Tech Co., Ltd.
Zhuhai Jiacheng Bio-Tech Co., Ltd. Supply pharmaceutical intermediates, steroid hormones, Trenbolone Enanthate, Testosterone Enanthate for bodybuilding use.
Home > Raw Steroid Powders >

Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding

Zhuhai Jiacheng Bio-Tech Co., Ltd.
Trust Seal
Verified Supplier
Credit Check
Supplier Assessment

Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding

Brand Name : KA-XING
Model Number : 315-37-7
Certification : HPLC and COA
Place of Origin : Guangdong ,China
MOQ : 50g
Price : Negotiated
Payment Terms : T/T,Moneygram, Western Union, Bitcoins
Supply Ability : 1T/month
Delivery Time : 3 days by DHL
Packaging Details : 5g,50g,100g,500g,1kg/foil bag or as requirements
Type : bodybuilding steroid
color : off-white crystalline powder
CAS : 315-37-7
Grade : Pharmaceutical Grade Carnitine
USe : muscle growth
users : Bodybuilders
Contact Now

CJC-1295 without DAC from Peptides
1.Quick Detail:

Product Name: CJC-1295
English name: CJC-1295 (without DAC)
CAS number: 863288-34-0
Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Tyr- Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular formula: C152H252N44O42
Molecular weight: 3367.97
Purity: 98%
Traits: white powder

CJC-1295 without DAC, a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively which can make the peptide more stable. One of its advantages over traditional GHRH is its ability to bioconjugate with serum albumin, thus increasing its half-life and therapeutic window. It accomplishes this by using protecting groups around the amino acids of GHRH typically susceptible to enzymatic degradation. In clinical research, the objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous HGH are presumed to increase lipolysis (fat loss).
2 How CJC-1295 Works
CJC-1295 acts for much longer than pure GRF. It acts on the pituitary gland and keeps stimulating the release of growth hormone in pulses. The peptide then finds a neucleophilic unit within the blood and reacts with it in order to create a firmer bond. The reason why it acts in pulses is because the axis of the human growth hormone controls how much of the hormone can remain in the body at a time. This maintains the homeostatic environment in the body.

3.The Effect;

For fat-loss, body-building, repair of injury: Multiple doses, together with exercise and a proper diet. This will reduce fat levels and add to muscle mass.

4. Packaging & Delivery:

Prudent packaging

5.Commerce clause:

Minimum Order Quantity: 100g
Delivery Time: 3 days
Payment Terms:TT, Moneygram and Western Union, Bitcoin, cash.
shipping partner: DHL, UPS, TNT, FEDEX, HKEMS

6.Our advantages:
1.Our company is a professional production leading factory in China in pharmaceutical area of 20years,our products have exported to Germany, Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, we had Established long friendly relations of cooperation
2. High quality, best price, first-class service, high successful delivery rate
3. We have stock at China, Europe, Canada, so we can delivery quickly at the very day when receive the payment
Contace setails:
Skype: linwenchen88

T-A002PEG MGF2mg
T-A003CJC-1295 with DAC2mg
T-A004CJC-1295 without DAC2mg
T-A015pentadecapeptide BPC 1572mg
T-A016HGH 176-1912mg
 HGH200iu kit
 HGH100iu kit
 HCG5000iu vial

Ostarine,MK-2866, Enobosarm841205-47-8
Andarine (S-4)401900-40-1
MK-677, Ibutamoren,mesylate159752-10-0

Product Tags:

muscle building steroids


muscle gaining steroids

China Customized Inflatable Bumper Ball Game Bubble Adult Grass CE supplier

Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding Images

Inquiry Cart 0
Send your message to this supplier
Enter your email please.
To: Zhuhai Jiacheng Bio-Tech Co., Ltd.
Characters Remaining: (0/3000)
Inquiry Cart 0